PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 595aa    MW: 66138 Da    PI: 6.6913
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093944311954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  XP_011077622.1 394 FEHflHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 431
                     554459******************************88 PP

2BELL96.42.5e-31276344472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e  +kk++Lls+l+eV+krYkqy++q+q+++ sFe v gl sa+p ++lA ka+S+hFrcLk+ai++q+
  XP_011077622.1 276 EETRKKSRLLSMLDEVYKRYKQYYQQMQVIVVSFESVSGLSSAAPLANLAFKALSKHFRCLKNAITDQL 344
                     6789**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.4E-36210342IPR006563POX domain
PfamPF075262.6E-33215341IPR006563POX domain
PROSITE profilePS5007112.082372435IPR001356Homeobox domain
CDDcd000863.85E-13375436No hitNo description
SMARTSM003892.9E-10375439IPR001356Homeobox domain
SuperFamilySSF466895.13E-17377442IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-27378439IPR009057Homeodomain-like
PfamPF059201.5E-18392431IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MAEGFESYHH VPQQSRRDRL RVNNPPVCLD NLHTPAGLLP LYDPSLISSD FINLHRQSFS  60
LGANTSAGVK EEGVNLMGFV GGMNVFSAAA TTSSSPRNLM YVDPQLNPSS IQDINVYSTA  120
THNYRGVLND QSFHGNEVAV YKPEPLSIAH HEPISNCGAA SGQSLSLSLS SHDHTHRNNN  180
LLPLELNLQR YDSSIELSWS SGPIGVGPFT GYASVLKGSR FLRPTQELMK ELCDECGGIY  240
SEKFAADSSL MDPPPLENWS RNVVVDNTVA LSDSGEETRK KSRLLSMLDE VYKRYKQYYQ  300
QMQVIVVSFE SVSGLSSAAP LANLAFKALS KHFRCLKNAI TDQLQFTAKS HDKKNYERNE  360
TRKLENGYND HQPVWRPQRG LPERAVAVLR AWLFEHFLHP YPTDTDKLML AKQTGLSRNQ  420
VSNWFINARV RLWKPMVEEV HMLETRQGQK DLQTDEQPAN RQNDHLPTSC SVQCKNASTS  480
IQKVGEFPLK RTRDDHLTET PAVSDQPMNL PYDKLLNHPQ LGIGVSNCSS GGGVSLTLGL  540
HQNGVGLSES YPINAASRFG LDEHGEGYVV SGFSEQSQEF GRDVVGGQLL HDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_B5e-16381439563Homeobox protein Meis2
4xrm_A5e-16381439563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077622.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
TrEMBLA5AHA10.0A5AHA1_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-84TALE family protein